PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_09338.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 157aa    MW: 18289.7 Da    PI: 9.7831
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_09338.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.54.2e-56161431128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL +k+++++++  ++i++vd++k+ePw+Lp+k+k + kewyfFs rd+ky+tg r+nrat++gyWk+t
  Rsa1.0_09338.1_g00002.1  16 LPPGFRFHPTDEELISYYLVNKIADQNFTG-KAIADVDLNKSEPWELPEKAKMGGKEWYFFSLRDRKYPTGVRTNRATNTGYWKTT 100
                              79*************************999.88***************99999********************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkdke+l++ ++elvg+kktLvfy+grap+gekt+Wvmheyrl
  Rsa1.0_09338.1_g00002.1 101 GKDKEILNStTSELVGMKKTLVFYRGRAPRGEKTSWVMHEYRL 143
                              *******9878889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.24E-5912150IPR003441NAC domain
PROSITE profilePS5100556.09216157IPR003441NAC domain
PfamPF023659.5E-3017143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MEQGDHQQQK KEEEALPPGF RFHPTDEELI SYYLVNKIAD QNFTGKAIAD VDLNKSEPWE  60
LPEKAKMGGK EWYFFSLRDR KYPTGVRTNR ATNTGYWKTT GKDKEILNST TSELVGMKKT  120
LVFYRGRAPR GEKTSWVMHE YRLHSKSSYR TSKISCL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-5371436140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2281411e-108AK228141.1 Arabidopsis thaliana mRNA for no apical meristem (NAM) -like protein, partial cds, clone: RAFL14-61-A06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013660050.11e-112PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotQ9FRV49e-76NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBLA0A078HD821e-112A0A078HD82_BRANA; BnaA09g41400D protein
STRINGfgenesh1_pg.C_scaffold_40003521e-111(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68512841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-113NAC domain containing protein 38